Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ydeH (ydeH)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ydeH (ydeH) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydeH

UniProt

P96665

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHIKWLSDLKKAGLLALGKGVITLLKRFSLVIVTLMMSIVVVLAAAKESPGDHVISFDE PIILMISIGIVVFLLIPPLVMSFFGNLVVRIISGVYQCFIVFTFLGLIPIGFLIPNGFLT ILVSIAGTLVSIASVAVTLCIGKNKKDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diphenyl Phosphite
TRC-D492245-50G 50 g

Diphenyl Phosphite

Sign In for Pricing
View Details
(2S)-2-Hydroxyglutaric Acid Octyl Ester Sodium Salt
TRC-H942596-5MG 5 mg

(2S)-2-Hydroxyglutaric Acid Octyl Ester Sodium Salt

Sign In for Pricing
View Details
Tissue Total RNA, Colon: rectosigmoid
CR560279 5 µg

Tissue Total RNA, Colon: rectosigmoid

Sign In for Pricing
View Details
p53 (TP53) Human Gene Knockout Kit (CRISPR)
KN200003RB 1 Kit

p53 (TP53) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse NFATc1 protein (His tag)
PDEM100279-01 20 µg

Recombinant Mouse NFATc1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse NFATc1 protein (His tag)
PDEM100279-02 100 µg

Recombinant Mouse NFATc1 protein (His tag)

Sign In for Pricing
View Details