Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywdE (ywdE)

This Recombinant Bacillus subtilis Uncharacterized protein ywdE (ywdE) spans the amino acid sequence from region 30-177.

Product Specifications

Product Name Alternative

Uncharacterized protein ywdE

UniProt

P39613

Expression Region

30-177

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASLPFVFLLDRLPDVVFTAGAILTLLCSYAYVWFWAVRFAYNQKMRLFEVQLGSFVLLAL MISLFLLDGSSMKDIMMNWDDAGCAFVPPAFTFLCLSYALVLLPVYQSKLWRLILPNGVR MKDIFHVFGDLMLIMVLLIGATLLFLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 650)
MBS6398147-01 0.1 mL

USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 650)

Sign In for Pricing
View Details
USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 650)
MBS6398147-02 5x 0.1 mL

USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 650)

Sign In for Pricing
View Details
TTC39A Adenovirus (Mouse)
48695055 1.0 mL

TTC39A Adenovirus (Mouse)

Sign In for Pricing
View Details
4-Fluorophenyl phenyl ether
sc-226655 5 mL

4-Fluorophenyl phenyl ether

Sign In for Pricing
View Details
1-Butyl-2-methylpyridinium hexafluorophosphate
IL-0127-HP-0500 500 g

1-Butyl-2-methylpyridinium hexafluorophosphate

Sign In for Pricing
View Details
Recombinant Pelotomaculum thermopropionicum UPF0756 membrane protein PTH_1817 (PTH_1817), partial
MBS7064503 Inquire

Recombinant Pelotomaculum thermopropionicum UPF0756 membrane protein PTH_1817 (PTH_1817), partial

Sign In for Pricing
View Details