Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant L-alanine exporter AlaE (alaE)

This Recombinant L-alanine exporter AlaE (alaE) spans the amino acid sequence from region 1-149.

Product Specifications

Product Name Alternative

L-alanine exporter AlaE

UniProt

P64551

Expression Region

1-149

Origin

Escherichia coli O6

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSPQSRLRHAVADTFAMVVYCSVVNMCIEVFLSGMSFEQSFYSRLVAIPVNILIAWPYG MYRDLFMRAARKVSPSGWIKNLADILAYVTFQSPVYVAILLVVGADWHQIMAAVSSNIVV SMLMGAVYGYFLDYCRRLFKVSRYQQVKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C16orf87 activation kit by CRISPRa
GA117935 1 Kit

Human C16orf87 activation kit by CRISPRa

Sign In for Pricing
View Details
Snx18 Mouse Gene Knockout Kit (CRISPR)
KN516430 1 Kit

Snx18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dynamin 3 (DNM3) (NM_015569) Human Over-expression Lysate
LY402450 100 µg

Dynamin 3 (DNM3) (NM_015569) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit
E-CL-R0374-01 24 Tests

Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit

Sign In for Pricing
View Details
Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit
E-CL-R0374-02 48 Tests

Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit

Sign In for Pricing
View Details
Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit
E-CL-R0374-03 96 Tests

Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit

Sign In for Pricing
View Details