Recombinant Escherichia coli Inner membrane protein ydcZ (ydcZ)
This Recombinant Escherichia coli Inner membrane protein ydcZ (ydcZ) spans the amino acid sequence from region 1-149.
Product Specifications
Product Name Alternative
Inner membrane protein ydcZ
UniProt
P76111
Expression Region
1-149
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNQSLTLAFLIAAGIGLVVQNTLMVRITQTSSTILIAMLLNSLVGIVLFVSILWFKQGMA GFGELVSSVRWWTLIPGLLGSFFVFASISGYQNVGAATTIAVLVASQLIGGLMLDIFRSH GVPLRALFGPICGAILLVVGAWLVARRSF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 