Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsule biosynthesis protein CapC (capC)

This Recombinant Capsule biosynthesis protein CapC (capC) spans the amino acid sequence from region 1-149.

Product Specifications

Product Name Alternative

Capsule biosynthesis protein CapC

UniProt

P19581

Expression Region

1-149

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGSDLYIALVLGVTLSLIFTERTGILPAGLVVPGYLALVFNQPVFMLVVLFISILTYVI VTYGVSRFMILYGRRKFAATLITGICLKLLFDYCYPVMPFEIFEFRGIGVIVPGLIANTI QRQGLPLTIGTTILLSGATFAIMNIYYLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-6411 miRNA Mimic
orb1874938-01 5 nmol

Mmu-miR-6411 miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-6411 miRNA Mimic
orb1874938-02 10 nmol

Mmu-miR-6411 miRNA Mimic

Sign In for Pricing
View Details
REST, ID (REST, NRSF, XBR, RE1-silencing transcription factor, Neural-restrictive silencer factor, X2 box repressor) (Biotin)
040963-Biotin 200 µL

REST, ID (REST, NRSF, XBR, RE1-silencing transcription factor, Neural-restrictive silencer factor, X2 box repressor) (Biotin)

Sign In for Pricing
View Details
TAT (Thrombin/Antithrombin Complex) BioAssayTM ELISA Kit (Rabbit) discontinued
359143-01 48 Tests

TAT (Thrombin/Antithrombin Complex) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
TAT (Thrombin/Antithrombin Complex) BioAssayTM ELISA Kit (Rabbit) discontinued
359143-02 96 Tests

TAT (Thrombin/Antithrombin Complex) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (FITC)
243943-FITC 100 µL

C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (FITC)

Sign In for Pricing
View Details