Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea sitchensis CASP-like protein 2

This Recombinant Picea sitchensis CASP-like protein 2 spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

CASP-like protein 2

UniProt

A9NTU2

Expression Region

1-150

Origin

Picea sitchensis (Sitka spruce) (Pinus sitchensis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPEAGDGRSGWRWVATFDLILRLAAIVATSTAVLAAMGKTFVVVVNGVACFYLLMSLPV SIFNIMRPGACPANRAVLTALDMVTVALVTAGALVAGILYLVHKAGDTHADWFSIWSQLD SLSYLAVLALILHVLLSGSILYKQALNIMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NOTUM Antibody [Janelia Fluor 646]
NBP1-77060JF646 0.1 mL

Rabbit Polyclonal NOTUM Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
SPB4, CT (SERPINB4, PI11, SCCA2, Serpin B4, Leupin, Peptidase inhibitor 11, Squamous cell carcinoma antigen 2) (AP) discontinued
042211-AP 200 µL

SPB4, CT (SERPINB4, PI11, SCCA2, Serpin B4, Leupin, Peptidase inhibitor 11, Squamous cell carcinoma antigen 2) (AP) discontinued

Sign In for Pricing
View Details
Syntenin-1 (SDCBP) Antibody
abx004101-01 60 µL

Syntenin-1 (SDCBP) Antibody

Sign In for Pricing
View Details
Syntenin-1 (SDCBP) Antibody
abx004101-02 120 µL

Syntenin-1 (SDCBP) Antibody

Sign In for Pricing
View Details
Syntenin-1 (SDCBP) Antibody
abx004101-03 200 µL

Syntenin-1 (SDCBP) Antibody

Sign In for Pricing
View Details
Recombinant Human TMEM240 Protein, His (Fc)-Avi-tagged
TMEM240-2208H 50 µg

Recombinant Human TMEM240 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details