Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype IB UPF0756 membrane protein YPTS_2884 (YPTS_2884)

This Recombinant Yersinia pseudotuberculosis serotype IB UPF0756 membrane protein YPTS_2884 (YPTS_2884) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

UPF0756 membrane protein YPTS_2884

UniProt

B2K990

Expression Region

1-150

Origin

Yersinia pseudotuberculosis serotype IB (strain PB1/+)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPLNSFFPWVEKYGLTIGVLIL TIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQPSVVAGLLV GTVLGVALFKGVPVGPLIAAGLLSLVIGKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-500 1x 500 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-100 1x 100 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-500 1x 500 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (197-2B1), CF640R conjugate, 0.1mg/mL
BNC400931-500 1x 500 µL

CD46 (197-2B1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL
BNC881025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details