Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yrzE (yrzE)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yrzE (yrzE) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yrzE

UniProt

O32051

Expression Region

1-150

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDGFEQKEQKPFNTGREETIMEETKQVGKGILYGLIAIFSAMLLTSLAVSLLLTATSLE ESSFNWLITAISFLSLFIGGFISGGKGKERGWMIGALTALSFSLIILLFQYLGFGKTFTA EQLIFHLGFLGVCMLGGIFGVNMRGNRSST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ryanodine Receptor 2, Cardiac (RYR2) ELISA Kit
RDR-RYR2-Hu-01 96 Tests

Human Ryanodine Receptor 2, Cardiac (RYR2) ELISA Kit

Sign In for Pricing
View Details
Human Ryanodine Receptor 2, Cardiac (RYR2) ELISA Kit
RDR-RYR2-Hu-02 48 Tests

Human Ryanodine Receptor 2, Cardiac (RYR2) ELISA Kit

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF647 conjugate, 0.1mg/mL
BNC471868-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF605 activation kit by CRISPRa
GA119247 1 Kit

Human ZNF605 activation kit by CRISPRa

Sign In for Pricing
View Details
HGH1 Antibody
KC-30859-01 50 μL

HGH1 Antibody

Sign In for Pricing
View Details
HGH1 Antibody
KC-30859-02 100 µL

HGH1 Antibody

Sign In for Pricing
View Details