Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0523 (AF_0523)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0523 (AF_0523) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0523

UniProt

O29727

Expression Region

1-150

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDNAKTSATDIVQRIISLLTIILLAYFLFKEGLFSVDQRLLSLATIVLLASFLFIIFLV LFKWPLGNLNKKEIRRTIAIVTTSFYFGTLSMVLSGKLELTEEVGALIDGLKWAFMVVVA FYFGSRAVEDALKSKKSAEECPQNTDAEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HLA-A*02:01&B2M&p53 (HMTEVVRRC) Tetramer Protein (MALS verified)
HLP-H82Ee-25ug 25 µg

Human HLA-A*02:01&B2M&p53 (HMTEVVRRC) Tetramer Protein (MALS verified)

Sign In for Pricing
View Details
DEME-6 shRNA Plasmid (m)
sc-142993-SH 20 µg

DEME-6 shRNA Plasmid (m)

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (rIGA/764), CF568 conjugate, 0.1mg/mL
BNC681862-100 1x 100 µL

CD79a (B-Cell Marker) (rIGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Amino-1-cyclopentylethan-1-ol hydrochloride
BDA06617-01 50 mg

2-Amino-1-cyclopentylethan-1-ol hydrochloride

Sign In for Pricing
View Details
2-Amino-1-cyclopentylethan-1-ol hydrochloride
BDA06617-02 0.5 g

2-Amino-1-cyclopentylethan-1-ol hydrochloride

Sign In for Pricing
View Details
TAB182 Peptide
orb1233476 0.1 mg

TAB182 Peptide

Sign In for Pricing
View Details