Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0523 (AF_0523)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0523 (AF_0523) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0523

UniProt

O29727

Expression Region

1-150

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDNAKTSATDIVQRIISLLTIILLAYFLFKEGLFSVDQRLLSLATIVLLASFLFIIFLV LFKWPLGNLNKKEIRRTIAIVTTSFYFGTLSMVLSGKLELTEEVGALIDGLKWAFMVVVA FYFGSRAVEDALKSKKSAEECPQNTDAEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ANKRD15 Antibody
NBP2-81953 0.1 mg

Rabbit Polyclonal ANKRD15 Antibody

Sign In for Pricing
View Details
Jacozine
T32252 25 mg

Jacozine

Sign In for Pricing
View Details
Polh Mouse shRNA Plasmid (Locus ID 80905)
TF505372 1 Kit

Polh Mouse shRNA Plasmid (Locus ID 80905)

Sign In for Pricing
View Details
ABC1 CRISPR Activation Plasmid (h2)
sc-401086-ACT-2 20 µg

ABC1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
PRKAR1B (NM_001164759) Human Tagged ORF Clone
RG228860 10 µg

PRKAR1B (NM_001164759) Human Tagged ORF Clone

Sign In for Pricing
View Details
SUHW1 Antibody
MBS8513244-01 0.05 mg

SUHW1 Antibody

Sign In for Pricing
View Details