Recombinant Actinobacillus pleuropneumoniae serotype 3 UPF0756 membrane protein APJL_0384 (APJL_0384)
Selected Variant
GTR19096506-01
Size: 20 µg
This Recombinant Actinobacillus pleuropneumoniae serotype 3 UPF0756 membrane protein APJL_0384 (APJL_0384) spans the amino acid sequence from region 1-150.
Product Specifications
Product Name Alternative
UPF0756 membrane protein APJL_0384
UniProt
B0BTB8
Expression Region
1-150
Origin
Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLQFNPISLFLVVLIFLGVVGNNNSITIAATVLLLVQQTFLSKYLPFLDKHGLSIGIII LTIGVLSPIVSGKISLPSFSEFLNWKMLLAVVAGIAVAWLGGRGVSLMGGQPLLVTGLLV GTIIGVALLGGVPVGPLIAAGILSLLIGKG
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471805-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942984-500 1x 500 µL
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680183-500 1x 500 µL
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472923-100 1x 100 µL
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details