Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukotriene C4 synthase (Ltc4s)

This Recombinant Mouse Leukotriene C4 synthase (Ltc4s) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

Leukotriene C4 synthase, LTC4 synthase, EC= 4.4.1.20, Leukotriene-C (4) synthase

UniProt

Q60860

Expression Region

1-150

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYF PLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVA MAALGLLVHFLPGTLRTALFRWLQMLLPMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ADSL Antibody
A03732-1 100 µg/Vial

Anti-ADSL Antibody

Sign In for Pricing
View Details
Recombinant Paramecium bursaria Chlorella virus 1 Potassium channel protein kcv (A250R), partial
MBS7112643 Inquire

Recombinant Paramecium bursaria Chlorella virus 1 Potassium channel protein kcv (A250R), partial

Sign In for Pricing
View Details
Rabbit anti Human ICAM2  Monoclonal Antibody
MBS2543937-01 0.06 mL

Rabbit anti Human ICAM2  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human ICAM2  Monoclonal Antibody
MBS2543937-02 0.12 mL

Rabbit anti Human ICAM2  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human ICAM2  Monoclonal Antibody
MBS2543937-03 0.2 mL

Rabbit anti Human ICAM2  Monoclonal Antibody

Sign In for Pricing
View Details
MF-Mouse TNF-α (Tumor Necrosis Factor Alpha) ELISA Kit
RE1060MF-01 48 Tests

MF-Mouse TNF-α (Tumor Necrosis Factor Alpha) ELISA Kit

Sign In for Pricing
View Details