Recombinant Rat Leukotriene C4 synthase (Ltc4s)
This Recombinant Rat Leukotriene C4 synthase (Ltc4s) spans the amino acid sequence from region 1-150.
Product Specifications
Product Name Alternative
Leukotriene C4 synthase, LTC4 synthase, EC= 4.4.1.20, Leukotriene-C (4) synthase
UniProt
Q925U2
Expression Region
1-150
Origin
Rattus norvegicus (Rat)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKEETALLATVTLVGVLLQAYFSLQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYF PLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQHRLDPLYASARALWLLVA MAALGLLVHFLPGTLRAALFRWLQVLLPMA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
134441-PE 100 µL
TIE2 (Angiopoietin-1 Receptor, Endothelial Tyrosine Kinase, Tunica Interna Endothelial Cell Kinase, Tyrosine Kinase with Ig and EGF Homology Domains-2, Tyrosine-protein Kinase Receptor TEK, Tyrosine-protein Kinase Receptor TIE-2, hTIE2, p140 TEK, CD202b, TEK, VMCM, VMCM1) (PE)
Sign In for Pricing
View Details K6961006 1.0 µg DNA
Syf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 