Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leukotriene C4 synthase (Ltc4s)

This Recombinant Rat Leukotriene C4 synthase (Ltc4s) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

Leukotriene C4 synthase, LTC4 synthase, EC= 4.4.1.20, Leukotriene-C (4) synthase

UniProt

Q925U2

Expression Region

1-150

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEETALLATVTLVGVLLQAYFSLQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYF PLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQHRLDPLYASARALWLLVA MAALGLLVHFLPGTLRAALFRWLQVLLPMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMLG (Calcium Signal-modulating Cyclophilin Ligand, CAML, CAML) (APC)
124305-APC 100 µL

CAMLG (Calcium Signal-modulating Cyclophilin Ligand, CAML, CAML) (APC)

Sign In for Pricing
View Details
Rabbit Anti-Human ZIP2 Polyclonal Antibody
PA89310HU-01 50 µg

Rabbit Anti-Human ZIP2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ZIP2 Polyclonal Antibody
PA89310HU-02 100 µg

Rabbit Anti-Human ZIP2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ZIP2 Polyclonal Antibody
PA89310HU-03 500 µg

Rabbit Anti-Human ZIP2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ZIP2 Polyclonal Antibody
PA89310HU-04 1 mg

Rabbit Anti-Human ZIP2 Polyclonal Antibody

Sign In for Pricing
View Details
CD105 Monoclonal Antibody
BT-MCA3999-01 50 µL

CD105 Monoclonal Antibody

Sign In for Pricing
View Details