Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Stage V sporulation protein AC (spoVAC)

This Recombinant Bacillus subtilis Stage V sporulation protein AC (spoVAC) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

Stage V sporulation protein AC

UniProt

P40868

Expression Region

1-150

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNIKENYKSKVKTYQPKPPYVWNCVKAFLVGGLICAIGQGLQNFYIHFFDFNEKTAGNP TAATLILISALLTGFGIYDRIGQFAGAGSAVPVTGFANSMASAALEYKSEGLVLGVATNM FKLAGNVIVFGVVAAYIVGMIRFAFEKLMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C-Peptide ELISA Kit PicoKine
MBS1759869-01 96 Well

Human C-Peptide ELISA Kit PicoKine

Sign In for Pricing
View Details
Human C-Peptide ELISA Kit PicoKine
MBS1759869-02 5x 96 Well

Human C-Peptide ELISA Kit PicoKine

Sign In for Pricing
View Details
ADCY6 Antibody
MBS9412710-01 0.1 mL

ADCY6 Antibody

Sign In for Pricing
View Details
ADCY6 Antibody
MBS9412710-02 5x 0.1 mL

ADCY6 Antibody

Sign In for Pricing
View Details
SHPRH (SNF2 Histone-linker PHD RING-finger Helicase, 2610103K11RIK, bA545I5.2, FLJ27258, FLJ37625, FLJ45012, FLJ90837, KIAA2023, MGC134886)
S1013-30W5 100 µg

SHPRH (SNF2 Histone-linker PHD RING-finger Helicase, 2610103K11RIK, bA545I5.2, FLJ27258, FLJ37625, FLJ45012, FLJ90837, KIAA2023, MGC134886)

Sign In for Pricing
View Details
Anti-PTPN9 Antibody Picoband®, iFluor647 Conjugate
A08233-1-iFluor647 100 µg

Anti-PTPN9 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details