Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Stage V sporulation protein AC (spoVAC)

This Recombinant Bacillus subtilis Stage V sporulation protein AC (spoVAC) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

Stage V sporulation protein AC

UniProt

P40868

Expression Region

1-150

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNIKENYKSKVKTYQPKPPYVWNCVKAFLVGGLICAIGQGLQNFYIHFFDFNEKTAGNP TAATLILISALLTGFGIYDRIGQFAGAGSAVPVTGFANSMASAALEYKSEGLVLGVATNM FKLAGNVIVFGVVAAYIVGMIRFAFEKLMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl β-D-thiogalactopyranoside
sc-221598 1 g

Ethyl β-D-thiogalactopyranoside

Sign In for Pricing
View Details
KDR / VEGFR-2 Antibody
orb621181-01 50 μL

KDR / VEGFR-2 Antibody

Sign In for Pricing
View Details
KDR / VEGFR-2 Antibody
orb621181-02 100 µL

KDR / VEGFR-2 Antibody

Sign In for Pricing
View Details
DESM Antibody
E45M02361G-1 100 µL

DESM Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PRAP1 Antibody [Alexa Fluor 350]
NBP2-99413AF350 0.1 mL

Rabbit Polyclonal PRAP1 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
SCML1 Protein Vector (Human) (pPM-C-HA)
PV128184 500 ng

SCML1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details