Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chemokine-like factor (Cklf)

This Recombinant Rat Chemokine-like factor (Cklf) spans the amino acid sequence from region 1-151.

Product Specifications

Product Name Alternative

Chemokine-like factor

UniProt

Q9JK79

Expression Region

1-151

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSPQKVVDHQPFCLSLKCFVKTLRLVVTVASMIFFIVAQAPEPYIVITGFEVTIILFLI ALYMCSLDKTMRSFFWPLLDVINSVVTTLFMLIVSVSALIPETSTMIMVGGVFGFLTVIC TVADCALMCQKLRFRPHGPYQNRSATDVDDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPA 124
B7222-1 1 mg

FPA 124

Sign In for Pricing
View Details
TCEA3 Antibody, HRP conjugated
CSB-PA023271LB01HU-01 50 µg

TCEA3 Antibody, HRP conjugated

Sign In for Pricing
View Details
TCEA3 Antibody, HRP conjugated
CSB-PA023271LB01HU-02 100 µg

TCEA3 Antibody, HRP conjugated

Sign In for Pricing
View Details
KCTD1 Antibody - C-terminal region
OAAB02368-400UL 400 µL

KCTD1 Antibody - C-terminal region

Sign In for Pricing
View Details
GABAA receptor modulator-2
MBS5805563 Inquire

GABAA receptor modulator-2

Sign In for Pricing
View Details
CHKB Recombinant Protein (Rat)
RP194849 100 µg

CHKB Recombinant Protein (Rat)

Sign In for Pricing
View Details