Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chemokine-like factor (Cklf)

This Recombinant Rat Chemokine-like factor (Cklf) spans the amino acid sequence from region 1-151.

Product Specifications

Product Name Alternative

Chemokine-like factor

UniProt

Q9JK79

Expression Region

1-151

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSPQKVVDHQPFCLSLKCFVKTLRLVVTVASMIFFIVAQAPEPYIVITGFEVTIILFLI ALYMCSLDKTMRSFFWPLLDVINSVVTTLFMLIVSVSALIPETSTMIMVGGVFGFLTVIC TVADCALMCQKLRFRPHGPYQNRSATDVDDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZEB2 Antibody - N-terminal region
ARP33695_P050-25UL 25 µL

ZEB2 Antibody - N-terminal region

Sign In for Pricing
View Details
Shisa Homolog 4 (SHISA4) Antibody
abx129451-01 100 µL

Shisa Homolog 4 (SHISA4) Antibody

Sign In for Pricing
View Details
Shisa Homolog 4 (SHISA4) Antibody
abx129451-02 200 µL

Shisa Homolog 4 (SHISA4) Antibody

Sign In for Pricing
View Details
Shisa Homolog 4 (SHISA4) Antibody
abx129451-03 1 mL

Shisa Homolog 4 (SHISA4) Antibody

Sign In for Pricing
View Details
Mouse Chd3 Pre-designed siRNA Set A
SI102508A 1 Each

Mouse Chd3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ELISA Kit FOR ORM1-like protein 3
E5048r 96 Tests

ELISA Kit FOR ORM1-like protein 3

Sign In for Pricing
View Details