Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Proteolipid protein 2 (Plp2)

This Recombinant Rat Proteolipid protein 2 (Plp2) spans the amino acid sequence from region 1-151.

Product Specifications

Product Name Alternative

Proteolipid protein 2

UniProt

Q6P742

Expression Region

1-151

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSERLSAPGCWLACTSFSRTKKGILLFAEIILCLVILICFSASTSAYSSLSVIEMIFA AVLFVFYMCDLHSKISFINWPWTDFFRSLIAAILYLITSIVVLVEGRGSSKIVAGVLGLL ATLLFGYDAYITFPLKQQRHTAAPTDPTDGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSMCE4A (NM_017615) Human 3' UTR Clone
SC202223 10 µg

NSMCE4A (NM_017615) Human 3' UTR Clone

Sign In for Pricing
View Details
EGR2 Protein Lysate (Mouse) with C-HA Tag
19046034 100 µg

EGR2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Glrx5 (NM_001108722) Rat Tagged Lenti ORF Clone
RR203945L4 10 µg

Glrx5 (NM_001108722) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Atf2 (NM_001284370) Mouse Tagged ORF Clone
MR229820 10 µg

Atf2 (NM_001284370) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Conjugated Renilla Luciferase Rabbit mAb
C58776 100 µL

Conjugated Renilla Luciferase Rabbit mAb

Sign In for Pricing
View Details
Zfp347 Rat siRNA Oligo Duplex (Locus ID 170902)
SR514230 1 Kit

Zfp347 Rat siRNA Oligo Duplex (Locus ID 170902)

Sign In for Pricing
View Details