Recombinant Danio rerio Melatonin receptor type 1A-like (mtnr1al)
This Recombinant Danio rerio Melatonin receptor type 1A-like (mtnr1al) spans the amino acid sequence from region 1-152.
Product Specifications
Product Name Alternative
Melatonin receptor type 1A-like, Mel-1A-R-like, Mel1a receptor-like, Melatonin receptor Mel1a Z1.4, zMel1a-2
UniProt
P51047
Expression Region
1-152
Origin
Danio rerio (Zebrafish) (Brachydanio rerio)
Field of Research
Pharmacology & Drug Discovery
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
CHSLKYDKLFSNKNTVCYVILVWALTVLAIVPNWFVESLQYDPRVFSCTFAQSVSSLYTI MVVVVHFIVPIGIVTYCYLRIWILVIQVPRRVKPDSRPKIKPHDFRNFLTMFVVFVLFAV CWAPLNFIGLAVAIHPRLGQSIPEWLFTASYF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040315-500 1x 500 µL
Heparan Sulphate Proteoglycan (A7L6), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400765-100 1x 100 µL
Chromogranin A (CHGA/765), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details