Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Chemokine-like factor (Cklf)

This Recombinant Mouse Chemokine-like factor (Cklf) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Chemokine-like factor

UniProt

Q9DAS1

Expression Region

1-152

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METPRPVVSRRPFCCTLKCFVKFLRLVVTVTSMIFFIVGQAPEPYIVITGFEVTVIFCFL VLYTCGLDKIMRSFFWPLLDVINSMVTALCMLIVSVLALIPETSTKTILGGVFGFLTVTC TIADCALMCQKLRFRPRQPYQKKSTNDIDDRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Katanin p60 A1 Double Nickase Plasmid (h2)
sc-411566-NIC-2 20 µg

Katanin p60 A1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Cadherin, Epithelial (CDHE) Recombinant, Human
153755-01 10 µg

Cadherin, Epithelial (CDHE) Recombinant, Human

Sign In for Pricing
View Details
Cadherin, Epithelial (CDHE) Recombinant, Human
153755-02 50 µg

Cadherin, Epithelial (CDHE) Recombinant, Human

Sign In for Pricing
View Details
Cadherin, Epithelial (CDHE) Recombinant, Human
153755-03 200 µg

Cadherin, Epithelial (CDHE) Recombinant, Human

Sign In for Pricing
View Details
Anti-CD81 antibody
STJ111247 100 µl

Anti-CD81 antibody

Sign In for Pricing
View Details
Mouse Endosulfine Alpha (ENSa) ELISA Kit
EKU03881-01 48 Tests

Mouse Endosulfine Alpha (ENSa) ELISA Kit

Sign In for Pricing
View Details