Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M4 Lipoprotein signal peptidase (lspA)

This Recombinant Streptococcus pyogenes serotype M4 Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II

UniProt

Q1J798

Expression Region

1-152

Origin

Streptococcus pyogenes serotype M4 (strain MGAS10750)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPFIPGIVSLTYLQNNGAAFSILQDQQ WFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRLAYVIDMVHLDF VDFAIFNVADSYLTVGVILLVICLWKEEDYGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC17 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06841 0.1 mg

TTC17 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
B56 beta Peptide
orb1234388 0.1 mg

B56 beta Peptide

Sign In for Pricing
View Details
Lentiviral human LEUTX shRNA (UAS) - Lentiviral human LEUTX shRNA (UAS, GFP) plasmid
GTR15109570 1 Vial

Lentiviral human LEUTX shRNA (UAS) - Lentiviral human LEUTX shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ATPB Blocking Peptide
MBS9620816-01 1 mg

ATPB Blocking Peptide

Sign In for Pricing
View Details
ATPB Blocking Peptide
MBS9620816-02 5x 1 mg

ATPB Blocking Peptide

Sign In for Pricing
View Details
Pira7 (NM_011094) Mouse Tagged Lenti ORF Clone
MR212230L4 10 µg

Pira7 (NM_011094) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details