Recombinant Staphylococcus saprophyticus subsp. saprophyticus Multidrug resistance efflux pump sepA (sepA)
This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Multidrug resistance efflux pump sepA (sepA) spans the amino acid sequence from region 1-152.
Product Specifications
Product Name Alternative
Multidrug resistance efflux pump sepA, Antiseptic resistance protein sepA, Staphylococcal efflux pump A
UniProt
Q49ZB2
Expression Region
1-152
Origin
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKYLRYLLTTLIVLSVFIISGAIFLTFLGFGLYGLSRILIYFHLAYFGYNKSFYDNLIYY GSYIVLGYFNLFIVENLMDYFRKKLPENLYFQGLTFQLITFSVTTLLFYFIVHIHYTYID IDFWVIVLIIGVLFICKEIFYPDSKNLNQKNK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400029-500 1x 500 µL
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details