Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1358 (MJ1358)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1358 (MJ1358) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1358

UniProt

Q58753

Expression Region

1-152

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVVFAFGFYLIFIKLTGLKLMDYFPRFKENRLKMIFSILSVILAFLINWLIMKNFSFLI EIIHPIASVWIFIILIYLLLRFLFLKRVPLSNYEKKFMGNMSAIAIFLELLKIIEYVDEH NIASPITVALVFFIPVVVFFNCKYFYEMELSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse gp130 Protein (Fc Tag)
PDMM100180-01 20 µg

Recombinant Mouse gp130 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse gp130 Protein (Fc Tag)
PDMM100180-02 100 µg

Recombinant Mouse gp130 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse gp130 Protein (Fc Tag)
PDMM100180-03 500 µg

Recombinant Mouse gp130 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse gp130 Protein (Fc Tag)
PDMM100180-04 1 mg

Recombinant Mouse gp130 Protein (Fc Tag)

Sign In for Pricing
View Details
RBMS2 (N-term) Rabbit Polyclonal Antibody
AP53615PU-N 400 µL

RBMS2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGS9 (NM_001081955) Human Over-expression Lysate
LY421179 100 µg

RGS9 (NM_001081955) Human Over-expression Lysate

Sign In for Pricing
View Details