Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L282 (MIMI_L282)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L282 (MIMI_L282) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Uncharacterized protein L282

UniProt

Q5UPW5

Expression Region

1-152

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLIVAISNFPAVLPIGLSFLKRDFITFGTITFVSIASFISHLIENHKHGMPGIGFSQQ TSYIWNRFDVLGCILSVARFSYLYYNRHGLTVVPIVNNKWLFAMTIPVFILLRVSEYDKY NPNLKTRYIITHCMWHAGIFGLMYYFLKNIVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LONP1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-4245R-APC-Cy7 100 µL

LONP1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Atorvastatin Epoxy Tetrahydrofuran Impurity
orb1992944-01 100 mg

Atorvastatin Epoxy Tetrahydrofuran Impurity

Sign In for Pricing
View Details
Atorvastatin Epoxy Tetrahydrofuran Impurity
orb1992944-02 50 mg

Atorvastatin Epoxy Tetrahydrofuran Impurity

Sign In for Pricing
View Details
Atorvastatin Epoxy Tetrahydrofuran Impurity
orb1992944-03 25 mg

Atorvastatin Epoxy Tetrahydrofuran Impurity

Sign In for Pricing
View Details
RhmD Antibody
orb825887 2 mg

RhmD Antibody

Sign In for Pricing
View Details
WDFY3 Rabbit Polyclonal Antibody (BF555)
orb2371817 100 µL

WDFY3 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details