Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Proteolipid protein 2 (PLP2)

This Recombinant Rabbit Proteolipid protein 2 (PLP2) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Proteolipid protein 2

UniProt

Q95MN6

Expression Region

1-152

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSERLSAPGCWAACTTFSRTRKGILLLAEIILCLVILICFSAGTSGYSSLSVVEMVLA IVFFVIYMCDLHTRAPFINWPWSDFFRTLIAAILYLITSIFVLVERGNHSKIAAGVLGLL ATCLFGYDAYFTFPLRQQRHTAAPTDPTDGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBF β Antibody
8C11013-AAT 50 µg

CBF β Antibody

Sign In for Pricing
View Details
DACH2 Human Gene Knockout Kit (CRISPR)
KN419595 1 Kit

DACH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF740 conjugate, 0.1mg/mL
BNC741917-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCAP1 (GUCA1A) (NM_000409) Human Over-expression Lysate
LC424724 20 µg

GCAP1 (GUCA1A) (NM_000409) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS703757 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Human P2Y8 (P2RY8) activation kit by CRISPRa
GA117305 1 Kit

Human P2Y8 (P2RY8) activation kit by CRISPRa

Sign In for Pricing
View Details