Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteolipid protein 2 (Plp2)

This Recombinant Mouse Proteolipid protein 2 (Plp2) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Proteolipid protein 2

UniProt

Q9R1Q7

Expression Region

1-152

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSERLSAPGCWLACTSFSRTKKGILLFAEIILCLVILICFSASTTSAYSSLSVIEMIC AAVLLVFYTCDLHSKISFINWPWTDFFRSLIATILYLITSIVVLVEGRGSSRVVAGILGL LATLLFGYDAYITFPLKQQRHTAAPTDPTDGP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Contactin 2 ELISA Kit
IHUCNTN2KT 1 Each

Human Contactin 2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)
MBS1039976-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)
MBS1039976-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)
MBS1039976-03 0.02 mg (Yeast)

Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)
MBS1039976-04 0.1 mg (Yeast)

Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)
MBS1039976-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O45:K1 Protein MraZ (mraZ)

Sign In for Pricing
View Details