Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteolipid protein 2 (Plp2)

This Recombinant Mouse Proteolipid protein 2 (Plp2) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Proteolipid protein 2

UniProt

Q9R1Q7

Expression Region

1-152

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSERLSAPGCWLACTSFSRTKKGILLFAEIILCLVILICFSASTTSAYSSLSVIEMIC AAVLLVFYTCDLHSKISFINWPWTDFFRSLIATILYLITSIVVLVEGRGSSRVVAGILGL LATLLFGYDAYITFPLKQQRHTAAPTDPTDGP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SerpinB1/ ELANH2 Protein, His-SUMO, E.coli-100ug
QP6668-ec-100ug 100ug

Recombinant Human SerpinB1/ ELANH2 Protein, His-SUMO, E.coli-100ug

Sign In for Pricing
View Details
Wsb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4695905 3x 1.0 µg

Wsb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti- Human /Mouse /Rat Full length Polyclonal Antibody
E53P07503 100 µL

Anti- Human /Mouse /Rat Full length Polyclonal Antibody

Sign In for Pricing
View Details
LRCH4 Rabbit Polyclonal Antibody (Fluoro488)
orb3093848 100 µg

LRCH4 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Recombinant Mouse Polynucleotide 5'-hydroxyl-kinase NOL9 (Nol9)
MBS1465363-01 0.02 mg (E-Coli)

Recombinant Mouse Polynucleotide 5'-hydroxyl-kinase NOL9 (Nol9)

Sign In for Pricing
View Details
Recombinant Mouse Polynucleotide 5'-hydroxyl-kinase NOL9 (Nol9)
MBS1465363-02 0.02 mg (Yeast)

Recombinant Mouse Polynucleotide 5'-hydroxyl-kinase NOL9 (Nol9)

Sign In for Pricing
View Details