Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL053C (YLL053C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL053C (YLL053C) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YLL053C

UniProt

P0CD98

Expression Region

1-152

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWFPQIIAGMAAGGAASAMTPGKVLFTNALGLGCSRSRGLFLEMFGTAVLCLTVLMTAVE KRETNFMAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLG AFLAWSVWQLLQILDYTTYVNAEKAAGQKKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NLN Protein Lysate
MBS8416075-01 0.02 mg

Human NLN Protein Lysate

Sign In for Pricing
View Details
Human NLN Protein Lysate
MBS8416075-02 5x 0.02 mg

Human NLN Protein Lysate

Sign In for Pricing
View Details
ANKRD16 (NM_001009942) Human Over-expression Lysate
LY423160 100 µg

ANKRD16 (NM_001009942) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CST3 Protein, His (Fc)-Avi-tagged
CST3-2744H 50 µg

Recombinant Human CST3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Canine Catestatin, CAT GENLISA ELISA
KLN0335 1x 96 Well

Canine Catestatin, CAT GENLISA ELISA

Sign In for Pricing
View Details
Zfp955a Protein Vector (Mouse) (pPM-C-HA)
PV250592 500 ng

Zfp955a Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details