Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL053C (YLL053C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL053C (YLL053C) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YLL053C

UniProt

P0CD98

Expression Region

1-152

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWFPQIIAGMAAGGAASAMTPGKVLFTNALGLGCSRSRGLFLEMFGTAVLCLTVLMTAVE KRETNFMAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLG AFLAWSVWQLLQILDYTTYVNAEKAAGQKKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NS1 (WNV)
IT-006-003-01 0.1 mL

Anti-NS1 (WNV)

Sign In for Pricing
View Details
Anti-NS1 (WNV)
IT-006-003-02 1 mL

Anti-NS1 (WNV)

Sign In for Pricing
View Details
Proapoptotic Caspase Adaptor Protein (MZB1) Human siRNA Oligo Duplex (Locus ID 51237)
SR309639 1 Kit

Proapoptotic Caspase Adaptor Protein (MZB1) Human siRNA Oligo Duplex (Locus ID 51237)

Sign In for Pricing
View Details
BTAF1 (human), (recombinant)
ENZ-PRT355-0050 50 μL

BTAF1 (human), (recombinant)

Sign In for Pricing
View Details
Marburg virus Antibody
GWB-257BF6 0.1 mg

Marburg virus Antibody

Sign In for Pricing
View Details
Histone H2A.X Polyclonal Antibody
E20-72155 100 µg

Histone H2A.X Polyclonal Antibody

Sign In for Pricing
View Details