Recombinant Saccharomyces cerevisiae Protein FYV5 (FYV5)
This Recombinant Saccharomyces cerevisiae Protein FYV5 (FYV5) spans the amino acid sequence from region 1-152.
Product Specifications
Product Name Alternative
Protein FYV5, Function required for yeast viability protein 5
UniProt
P25585
Expression Region
1-152
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MQYHSALYVYIYVTFTTIPYKEKPDIISICFSMLSFVFDFSVRICSRTLESFSWSLISSS AFKVVSAFSLAGSCVLASRSSVGIIVSLLLFNFSTCNFVLFLSAVLIDLFFCTFLPTPTF LPTPFFFMLHLPIFSLLNALELLYLIIAGLHI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472424-500 1x 500 µL
BOB.1 (B-Cell Marker) (BOB1/2424), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740629-500 1x 500 µL
CD59 (heavy chain of Protectin) (MACIF/629), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400041-500 1x 500 µL
Cytokeratin 18 (C-04), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details