Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yjiG (yjiG)

This Recombinant Inner membrane protein yjiG (yjiG) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

Inner membrane protein yjiG

UniProt

P0AEH9

Expression Region

1-153

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTQVRKNVMDMFIDGARRGFTIATTNLLPNVVMAFVIIQALKITGLLDWVGHICEPVMA LWGLPGEAATVLLAALMSMGGAVGVAASLATAGALTGHDVTVLLPAMYLMGNPVQNVGRC LGTAEVNAKYYPHIITVCVINALLSIWVMQLIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chst7 Mouse Gene Knockout Kit (CRISPR)
KN503330 1 Kit

Chst7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Villin (VIL1) Rabbit Polyclonal Antibody
TA361527 100 µL

Villin (VIL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCN4B Human Gene Knockout Kit (CRISPR)
KN423951 1 Kit

SCN4B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
trans-Nerolidol
TRC-N385710-500MG 500 mg

trans-Nerolidol

Sign In for Pricing
View Details
R-96544 Hydrochloride
TRC-H942928-25MG 25 mg

R-96544 Hydrochloride

Sign In for Pricing
View Details
NLRP3 (NM_001127461) Human Over-expression Lysate
LC426795 20 µg

NLRP3 (NM_001127461) Human Over-expression Lysate

Sign In for Pricing
View Details