Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Prostaglandin E synthase (PTGES)

This Recombinant Bovine Prostaglandin E synthase (PTGES) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

Prostaglandin E synthase, EC= 5.3.99.3, Microsomal prostaglandin E synthase 1, MPGES-1

UniProt

Q95L14

Expression Region

1-153

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPSGLELMNGQVLPAFLLCSALLVIKMYVVAVITGQVRLRKKAFANPEDAQRHGGLQYC RNDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVARMHFLVFFLGRMVHTVAYLG KLRAPTRSLAYTLAQLPCASMALQIVWEAARHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CChMVd TaqMan Probe/Primer and Control Set
TM35510 100 Reactions

CChMVd TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
STT3A Rabbit Polyclonal Antibody
TA365909 100 µL

STT3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTSO Antibody
KC-27197-01 50 μL

CTSO Antibody

Sign In for Pricing
View Details
CTSO Antibody
KC-27197-02 100 µL

CTSO Antibody

Sign In for Pricing
View Details
CTSO Antibody
KC-27197-03 1 mL

CTSO Antibody

Sign In for Pricing
View Details
TentaGel® MB AC
MB250110.1G 1 g

TentaGel® MB AC

Sign In for Pricing
View Details