Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus sakei subsp. sakei UPF0756 membrane protein LSA1031 (LSA1031)

This Recombinant Lactobacillus sakei subsp. sakei UPF0756 membrane protein LSA1031 (LSA1031) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

UPF0756 membrane protein LSA1031

UniProt

Q38WU8

Expression Region

1-153

Origin

Lactobacillus sakei subsp. sakei (strain 23K)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESWLFLAAILIVALLAKNQSLIIATAVVLVLKALPISEKVLPVIQAKGINWGVTVISVA ILVPIATGQIGFKELISAFKTPAGFIAVGCGVLVAVLSAKGVGLLAASPEMTVALVFGTI MGVVFLKGIAAGPVIAAGITYTILTIFNLVPIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-100 1x 100 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF640R conjugate, 0.1mg/mL
BNC402955-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF488A conjugate, 0.1mg/mL
BNC881920-500 1x 500 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details