Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Myelin and lymphocyte protein (MAL)

This Recombinant Bovine Myelin and lymphocyte protein (MAL) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

Myelin and lymphocyte protein

UniProt

Q3ZBY0

Expression Region

1-153

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPSAASGVSSLPSGFAVFTTFPDLLFIFEFVFGGLVWILVSSSHVPIPLIQGWVMFASV FCFVATTVLAFLYVIGAHGNRTSWITLDAAYHCVASLFYFGASVLEALAAIQLQDGFLYK YYHENISAVVFSYVATLLYVVHAVFSLIRWKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF568 conjugate, 0.1mg/mL
BNC682385-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF405S conjugate, 0.1mg/mL
BNC041819-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF647 conjugate, 0.1mg/mL
BNC472312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details