Recombinant Bacillus thuringiensis subsp. konkukian UPF0756 membrane protein BT9727_4324 (BT9727_4324)
This Recombinant Bacillus thuringiensis subsp. konkukian UPF0756 membrane protein BT9727_4324 (BT9727_4324) spans the amino acid sequence from region 1-153.
Product Specifications
Product Name Alternative
UPF0756 membrane protein BT9727_4324
UniProt
Q6HCT7
Expression Region
1-153
Origin
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682097-100 1x 100 µL
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY429673 100 µg
Persephin receptor (GFRA4) (NM_022139) Human Over-expression Lysate
Sign In for Pricing
View Details 
