Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Deinococcus radiodurans Probable disulfide formation protein (DR_0754)

This Recombinant Deinococcus radiodurans Probable disulfide formation protein (DR_0754) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

Probable disulfide formation protein, Disulfide oxidoreductase, Thiol-disulfide oxidoreductase

UniProt

Q9RWB5

Expression Region

1-153

Origin

Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRDTRLYLAWLVALAATLGSLYFSEIRHFNPCPLCWAQRIFMYPLAVILGIAAFVGDHG VRRYVLPLAALGLGFAIFQNLETWGFVQSIKACTVNAAAACNTPWPVWGTSQDTLNRALT IPVLSMIAFALILALLSWPRQRVTVPESAAVQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS642517 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Her2 (ERBB2) (NM_004448) Human Recombinant Protein
TP710036 20 µg

Her2 (ERBB2) (NM_004448) Human Recombinant Protein

Sign In for Pricing
View Details
KRT13 Human Gene Knockout Kit (CRISPR)
KN401179 1 Kit

KRT13 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C4orf54 activation kit by CRISPRa
GA117236 1 Kit

Human C4orf54 activation kit by CRISPRa

Sign In for Pricing
View Details
JunB (Ab-259) Antibody
8B7135-AAT 50 µg

JunB (Ab-259) Antibody

Sign In for Pricing
View Details
Tulobuterol-d9 Hydrochloride
TRC-T897252-2.5MG 2.5 mg

Tulobuterol-d9 Hydrochloride

Sign In for Pricing
View Details