Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Deinococcus radiodurans Probable disulfide formation protein (DR_0754)

This Recombinant Deinococcus radiodurans Probable disulfide formation protein (DR_0754) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

Probable disulfide formation protein, Disulfide oxidoreductase, Thiol-disulfide oxidoreductase

UniProt

Q9RWB5

Expression Region

1-153

Origin

Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRDTRLYLAWLVALAATLGSLYFSEIRHFNPCPLCWAQRIFMYPLAVILGIAAFVGDHG VRRYVLPLAALGLGFAIFQNLETWGFVQSIKACTVNAAAACNTPWPVWGTSQDTLNRALT IPVLSMIAFALILALLSWPRQRVTVPESAAVQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Topoisomerase I (TOP1) Rabbit Polyclonal Antibody
TA382705 100 µL

Topoisomerase I (TOP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), CF488A conjugate, 0.1mg/mL
BNC882047-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D205), 1mg/mL
BNUM0205-50 1x 50 µL

Complement C4d (C4D205), 1mg/mL

Sign In for Pricing
View Details
PmL Protein (PmL) Human Gene Knockout Kit (CRISPR)
KN200700 1 Kit

PmL Protein (PmL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Taf1b activation kit by CRISPRa
GA204199 1 Kit

Mouse Taf1b activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB602260 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details