Recombinant Rabbit Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)
This Recombinant Rabbit Arachidonate 5-lipoxygenase-activating protein (ALOX5AP) spans the amino acid sequence from region 1-153.
Product Specifications
Product Name Alternative
Arachidonate 5-lipoxygenase-activating protein, FLAP, MK-886-binding protein
UniProt
P30357
Expression Region
1-153
Origin
Oryctolagus cuniculus (Rabbit)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDQEAVGNVVLLAIVTLISVVQNGFFAHKVEHESRNQNGRSFQRTGTLAFERVYTANQNC VDAYPTFLAVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSLAGILNYCLILLFGSDFENYIKTISTT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880270-500 1x 500 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400139-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (57), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details