Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1823 (AF_1823)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1823 (AF_1823) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1823

UniProt

O28452

Expression Region

1-154

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIDTLIIAVAGLFAVASSIGVLLTKDNFYAALYMSVTMLFVAAIYAAFNIQPVVVIIAL IFVGAVGIVTVAIAATYRAGVSRKVNIFWVVPVIVVFAILALAYASMAVESIEVVNPEVF SAVATDYFFVVAFLFTLVVLMMLSAIKLARRVDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF647 conjugate, 0.1mg/mL
BNC472807-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703026 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
NCR1 (NM_001145458) Human Recombinant Protein
TP326814 20 µg

NCR1 (NM_001145458) Human Recombinant Protein

Sign In for Pricing
View Details
Transglutaminase 2 Antibody
8C0350-AAT 50 µg

Transglutaminase 2 Antibody

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF647 conjugate, 0.1mg/mL
BNC470045-100 1x 100 µL

Bcl-2 (100/D5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP-9 Recombinant Rabbit Monoclonal Antibody [PSH06-33]
HA722665 100 µL

MMP-9 Recombinant Rabbit Monoclonal Antibody [PSH06-33]

Sign In for Pricing
View Details