Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1823 (AF_1823)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1823 (AF_1823) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1823

UniProt

O28452

Expression Region

1-154

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIDTLIIAVAGLFAVASSIGVLLTKDNFYAALYMSVTMLFVAAIYAAFNIQPVVVIIAL IFVGAVGIVTVAIAATYRAGVSRKVNIFWVVPVIVVFAILALAYASMAVESIEVVNPEVF SAVATDYFFVVAFLFTLVVLMMLSAIKLARRVDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHKG1 (NM_006213) Human Over-expression Lysate
LC401872 20 µg

PHKG1 (NM_006213) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Acetyl-L-cysteine-13C3,15N
TRC-A172094-2.5MG 2.5 mg

N-Acetyl-L-cysteine-13C3,15N

Sign In for Pricing
View Details
IKK-β (Ab-188) Antibody
8B0442-AAT 50 µg

IKK-β (Ab-188) Antibody

Sign In for Pricing
View Details
FCER1G (NM_004106) Human Recombinant Protein
TP307585L 1 mg

FCER1G (NM_004106) Human Recombinant Protein

Sign In for Pricing
View Details
E2f (480-493) Goat Polyclonal Antibody
AP32085PU-N 100 µg

E2f (480-493) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Mouse TULp2 activation kit by CRISPRa
GA206070 1 Kit

Mouse TULp2 activation kit by CRISPRa

Sign In for Pricing
View Details