Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1823 (AF_1823)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1823 (AF_1823) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1823

UniProt

O28452

Expression Region

1-154

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIDTLIIAVAGLFAVASSIGVLLTKDNFYAALYMSVTMLFVAAIYAAFNIQPVVVIIAL IFVGAVGIVTVAIAATYRAGVSRKVNIFWVVPVIVVFAILALAYASMAVESIEVVNPEVF SAVATDYFFVVAFLFTLVVLMMLSAIKLARRVDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLGLB1 (PLGLB2) (NM_002665) Human Over-expression Lysate
LY419172 100 µg

PLGLB1 (PLGLB2) (NM_002665) Human Over-expression Lysate

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF647 conjugate, 0.1mg/mL
BNC470417-100 1x 100 µL

Fascin-1 (FSCN1/417), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
m-Toluidine
TRC-T536225-25G 25 g

m-Toluidine

Sign In for Pricing
View Details
DPP8 (NM_197960) Human Over-expression Lysate
LC430697 20 µg

DPP8 (NM_197960) Human Over-expression Lysate

Sign In for Pricing
View Details
(R)-N-(2-hydroxy-2-phenylethyl)-N-(4-nitrophenethyl)nitrous amide
TRC-H181965-25MG 25 mg

(R)-N-(2-hydroxy-2-phenylethyl)-N-(4-nitrophenethyl)nitrous amide

Sign In for Pricing
View Details
CF®568 Arachis hypogaea Lectin PNA (Peanut)
#29061 1x 1 mg

CF®568 Arachis hypogaea Lectin PNA (Peanut)

Sign In for Pricing
View Details