Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Microsomal glutathione S-transferase 1 (Mgst1)

This Recombinant Mouse Microsomal glutathione S-transferase 1 (Mgst1) spans the amino acid sequence from region 2-155.

Product Specifications

Product Name Alternative

Microsomal glutathione S-transferase 1, Microsomal GST-1, EC= 2.5.1.18, Microsomal GST-I

UniProt

Q91VS7

Expression Region

2-155

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ADLRQLMDNEVLMAFTSYATIILTKMMFMSSATAFQRITNKVFANPEDCAGFGKGENAKK FVRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALMHFRIFVGARIYHTIAY LTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,N4-Etheno-2'-deoxycytidine-13C,15N2
TRC-E677902-2.5MG 2.5 mg

3,N4-Etheno-2'-deoxycytidine-13C,15N2

Sign In for Pricing
View Details
DPP6 Rabbit Polyclonal Antibody
ER1902-07 100 µL

DPP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ITGA2B Antibody
OC-521-01 50 μL

ITGA2B Antibody

Sign In for Pricing
View Details
ITGA2B Antibody
OC-521-02 100 µL

ITGA2B Antibody

Sign In for Pricing
View Details
ITGA2B Antibody
OC-521-03 1 mL

ITGA2B Antibody

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (rS100A4/1481), CF647 conjugate, 0.1mg/mL
BNC473186-100 1x 100 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (rS100A4/1481), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details