Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microsomal glutathione S-transferase 1 (MGST1)

This Recombinant Human Microsomal glutathione S-transferase 1 (MGST1) spans the amino acid sequence from region 2-155.

Product Specifications

Product Name Alternative

Microsomal glutathione S-transferase 1, Microsomal GST-1, EC= 2.5.1.18, Microsomal GST-I

UniProt

P10620

Expression Region

2-155

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKK YLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAY LTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myometrium
CS620372 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
MNDA (NM_002432) Human Over-expression Lysate
LC400871 20 µg

MNDA (NM_002432) Human Over-expression Lysate

Sign In for Pricing
View Details
IL17F (NM_052872) Human Recombinant Protein
TP720022 10 µg

IL17F (NM_052872) Human Recombinant Protein

Sign In for Pricing
View Details
Tuft1 Mouse Gene Knockout Kit (CRISPR)
KN518484 1 Kit

Tuft1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IGFBP-2 Antibody Pair Set
E-KAB-0430 50 µL & 100 µg

Human IGFBP-2 Antibody Pair Set

Sign In for Pricing
View Details
LHPP (NM_001167880) Human Over-expression Lysate
LY432687 100 µg

LHPP (NM_001167880) Human Over-expression Lysate

Sign In for Pricing
View Details