Recombinant Schizosaccharomyces pombe Putative uncharacterized transporter C977.04 (SPAC977.04)
This Recombinant Schizosaccharomyces pombe Putative uncharacterized transporter C977.04 (SPAC977.04) spans the amino acid sequence from region 1-155.
Product Specifications
Product Name Alternative
Putative uncharacterized transporter C977.04
UniProt
G2TRN8
Expression Region
1-155
Origin
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPINQKFYSYLVKRNGGEGEPEFRLPMGFIGITLFEIGILLFGWTARYKIFWFVPTIGSA IMGGGYIMTSNPLNMYVVDSYGIYSASASAGVKIFQLLLGAIFPLFAESLFRRLNYGWGC TLLAFILLACGCSLPILFKYGKQIRNLRPFDPSKY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040040-100 1x 100 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740217-500 1x 500 µL
Human IgG Immunoglobulin (IG217), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681887-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680756-100 1x 100 µL
Neurofilament (H+L) (NF421 + NFL736), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details