Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ytaB (ytaB)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ytaB (ytaB) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ytaB

UniProt

O34694

Expression Region

1-155

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISL SAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLI IAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STREM-1 (Soluble Triggering Receptor Expressed on Myeloid Cells-1) BioAssayTM ELISA Kit (Human) discontinued
384521 96 Tests

STREM-1 (Soluble Triggering Receptor Expressed on Myeloid Cells-1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Genomic Mini AX Stool
065-60 60 Isolations

Genomic Mini AX Stool

Sign In for Pricing
View Details
C1orf98 Protein Vector (Human) (pPB-C-His)
PV066269 500 ng

C1orf98 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
MC5R, CT (MC5R, Melanocortin receptor 5, MC-2) (MaxLight 405) discontinued
038258-ML405 100 µL

MC5R, CT (MC5R, Melanocortin receptor 5, MC-2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
AREG Antibody
DF6665-01 100 µL

AREG Antibody

Sign In for Pricing
View Details
AREG Antibody
DF6665-02 200 µL

AREG Antibody

Sign In for Pricing
View Details