Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ytaB (ytaB)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ytaB (ytaB) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ytaB

UniProt

O34694

Expression Region

1-155

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISL SAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLI IAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBL (Target of Rapamycin Complex Subunit LST8, TORC Subunit LST8, G-Protein beta Subunit-like, Gable, Protein GbetaL, Mammalian Lethal with SEC13 Protein 8, mLST8, MLST8, LST8)
140364 200 µL

GBL (Target of Rapamycin Complex Subunit LST8, TORC Subunit LST8, G-Protein beta Subunit-like, Gable, Protein GbetaL, Mammalian Lethal with SEC13 Protein 8, mLST8, MLST8, LST8)

Sign In for Pricing
View Details
MAPK11 Antibody
orb1263175 400 μl

MAPK11 Antibody

Sign In for Pricing
View Details
MICA/B Human Monoclonal Antibody (APC)
orb2972617-01 50 Tests

MICA/B Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details
MICA/B Human Monoclonal Antibody (APC)
orb2972617-02 100 Tests

MICA/B Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details
Human Ubiquilin-2 (UBQLN2) ELISA Kit
MBS9713764-01 48 Tests

Human Ubiquilin-2 (UBQLN2) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquilin-2 (UBQLN2) ELISA Kit
MBS9713764-02 96 Tests

Human Ubiquilin-2 (UBQLN2) ELISA Kit

Sign In for Pricing
View Details