Recombinant Human V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)
This Recombinant Human V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) spans the amino acid sequence from region 1-155.
Product Specifications
Product Name Alternative
V-type proton ATPase 16 kDa proteolipid subunit, V-ATPase 16 kDa proteolipid subunit, Vacuolar proton pump 16 kDa proteolipid subunit
UniProt
P27449
Expression Region
1-155
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 