Recombinant Bovine Protein SYS1 homolog (SYS1)
This Recombinant Bovine Protein SYS1 homolog (SYS1) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
Protein SYS1 homolog
UniProt
Q1RMQ3
Expression Region
1-156
Origin
Bos taurus (Bovine)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVHSSPSLDQVFDAEILGFST PPGRLSTMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWLYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRSELKEIPLNSAPKSSV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040204-500 1x 500 µL
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880008-500 1x 500 µL
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details