Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1492 (MJ1492)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1492 (MJ1492) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1492

UniProt

Q58887

Expression Region

1-156

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKYYLIVLISFLIFYLSIFLAPYFAYLGETSNFWKFISICLYAVYSLICHQMPQRSFFI FGHKMAVCARCFGIYTGVLVGMIIYPFIKKLDDFKIPNKWYLIIALIPMAVDGTTQLIGL RESFNELRFITGFIAGFTVVFYILPIFFEMIYKKFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P cadherin (CDH3) Human Gene Knockout Kit (CRISPR)
KN207346 1 Kit

P cadherin (CDH3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant p16 ARC Antibody
RC-16834-01 50 μL

Recombinant p16 ARC Antibody

Sign In for Pricing
View Details
Recombinant p16 ARC Antibody
RC-16834-02 100 µL

Recombinant p16 ARC Antibody

Sign In for Pricing
View Details
Recombinant p16 ARC Antibody
RC-16834-03 1 mL

Recombinant p16 ARC Antibody

Sign In for Pricing
View Details
CD79a (JCB117), 0.2mg/mL
BNUB0476-500 1x 500 µL

CD79a (JCB117), 0.2mg/mL

Sign In for Pricing
View Details
ANKRD40 Human qPCR Primer Pair (NM_052855)
HP216487 200 Reactions

ANKRD40 Human qPCR Primer Pair (NM_052855)

Sign In for Pricing
View Details